Foundational guide
Sermorelin Where to Buy: Grade the Document, Not the Brand
Six criteria that separate a supplier from a repackager, each written so it can be failed. Applied here to the certificate for lot 38-01260229, which passes four of them cleanly, fails one, and cannot be graded on the sixth.
Sermorelin where to buy is usually answered with a list of shop names. A list is the least durable form an answer can take: vendors change hands, batches change laboratories, and a recommendation made in February describes material that has since been replaced.
A method survives that. Below are six criteria, each phrased so a supplier can fail it, then the same six applied to the one certificate we hold. The supplier this page links to passes four, fails one and cannot be graded on the sixth, and saying so is the only way the exercise is worth reading.
Supplier publishing lot-level data
Sermorelin, Ascension Peptides
This lot carries a certificate from one independent laboratory. The code below halves the listed price on the vial.
The published certificate for lot 38-01260229 assays this vial at 11.31 mg against a 10 mg label, and reports purity and quantity only, with no endotoxin or sterility testing. Buying 3, 5 or 10 takes 3%, 5% or 10% off the list price. Free shipping starts at $250.
- MZ Biolabs certificate for lot 38-01260229
- Carriage free above $250
- Same-day dispatch before 2pm CST
Supplied for laboratory research use and not for human consumption. Affiliate links: a commission may be earned at no cost to the reader, and it does not affect the assessment above. Prices verified September 6, 2026.
Sermorelin where to buy: six criteria, each written to be failed
A criterion that cannot be failed is a slogan. “High quality” and “trusted supplier” are unfalsifiable, so they carry no information. Each line below names a document, a method or an outcome that either exists or does not.
| Criterion | A pass requires | Lot 38-01260229 |
|---|---|---|
| Batch-specific certificate | A lot number on the document that matches the vial being sold | Pass. Lot named, certificate linked from the listing |
| Purity by a named method | A percentage with the technique and peak count stated | Pass. 99.79 percent, HPLC-UV-MS, four detected peaks |
| Identity against the expected molecule | Sequence of 29 residues, C-terminal amide, mass near 3357.9 g/mol | Pass. Sequence converts to canonical GHRH(1-29) amide |
| Quantity against label | A measured mass, not a restatement of the printed one | Pass. 11.31 mg measured on a 10 mg label |
| Microbiological testing | A bacterial endotoxin result and a sterility screen on the same lot | Fail. Neither appears on this certificate |
| Recourse and refunds | Published terms plus evidence of how they are honoured | Ungradeable from public information |
Row six is deliberately not a pass. A published returns policy is a promise, and a promise is not evidence. Grading it would require a sample of disputes we do not have, so it stays open rather than being quietly counted in the supplier’s favour.
Running the identity criterion yourself
This is the check most buyers assume they cannot do, and it takes about a minute. The certificate prints the peptide sequence in three-letter code. Convert it to single-letter code and it reads YADAIFTNSYRKVLGQLSARKLLQDIMSR. Count the residues: twenty-nine. Look for the C-terminal amide notation. That combination is the canonical GHRH(1-29) amide, which is what sermorelin is.
Then cross the molecule against a public database. PubChem CID 16132413 returns the title Sermorelin, the molecular formula C149H246N44O42S and a molecular weight of 3357.9. The vendor’s own product description gives the same formula and the same mass. Two sources that were not written by each other agreeing on a formula is not proof that the powder in the vial matches, but a disagreement would be proof that something is wrong, and that asymmetry is what makes the check worth running.
The failure mode this catches is substitution within a category. Growth hormone secretagogues are sold as an interchangeable family, and they are not one: tesamorelin is a modified GHRH analog, while ipamorelin and MK-677 act at the ghrelin receptor and share no sequence with sermorelin at all. A residue count and a formula separate them immediately. The wider point about what research peptides are applies here in full.
The criterion this supplier fails, stated plainly
The certificate for lot 38-01260229 reports purity and quantity. It carries no bacterial endotoxin result and no sterility screen. For a lyophilised powder that a buyer will reconstitute, that is the gap with the most practical consequence, and it is the one line on the scorecard we would want a reader to check before anything else.
The reason it matters is not hypothetical. FDA’s stated concern about this class of peptide, in the context of substances flagged for compounding risk, is immunogenicity arising from aggregation and peptide-related impurities. Endotoxin and sterility testing is the standard way that question gets asked of injectable material, and it is a separate analysis from the chromatography that produced the purity number. A result of 99.79 percent says nothing about pyrogens at any decimal place.
Two ways of writing that fact exist and only one is defensible. This lot’s certificate covers purity and quantity: that is a statement about a document, and it is verifiable by opening the document. The vendor does not test for endotoxin: that is a statement about a company, and we have no basis for it. Test scope is a property of a batch, and the same supplier’s other products have carried wider panels on some lots than on others.
Where domestic stock belongs on the list
Origin is the criterion buyers weigh most heavily and the one that says least about the material. Shipping from inside the United States removes a customs interception, cuts transit time and the heat exposure that comes with it, and leaves a counterparty in a jurisdiction where a chargeback or a refund demand has somewhere to go. Those are real benefits and all four are about logistics.
None of them alters what is in the vial. A domestic seller with no lot-level certificate is selling unverifiable powder with a shorter tracking number, and an overseas seller publishing a full analytical panel is selling better-characterised material that takes longer to arrive. Ranking origin above documentation inverts the order in which those two facts matter. The sensible use of the criterion is as a tiebreak between suppliers that have already passed the document tests, not as a substitute for them.
It also decides how much of the certificate you can still rely on when the box arrives. A quantity result is a measurement made on one date in a laboratory, and nothing about a long transit improves it. The chain from that analysis to the vial in your hand is what the delivery sequence is for, and we follow it through in the ordering walkthrough.
What the scorecard costs to act on
List is $99.99, the site charges $72.00, and the code takes it to $36.00, which is $3.60 per labelled milligram. Dividing instead by the 11.31 mg this lot assayed gives $3.18. Buying three, five or ten reduces the list price by 3, 5 or 10 percent as a separate mechanism, and carriage is free above $250.
A price that low against a discontinued prescription drug invites a comparison that does not hold. What is being bought is unlicensed research material with a two-result certificate, not a dispensed medicine, and the difference is a matter of what documentation comes with it rather than a discount. The two purchases are set side by side, with what each actually asks of the buyer, in our channel comparison.
The claims that score nothing at all
Some listing language is not weak evidence but zero evidence, and it is worth naming so it stops occupying attention. “Pharmaceutical grade” has no issuing body in this market. “GMP facility”, with no facility name and no registration number, points at nothing checkable. “Third party tested”, without the third party’s name and the lot they tested, is the claim with the evidence removed. Each of those becomes gradeable the moment a document is attached to it, and unfalsifiable until then.
The other zero-evidence category is history borrowed from the compound rather than the product. Sermorelin genuinely was an approved drug: Geref held NDA 019863 for pituitary diagnostics and NDA 020443 for therapeutic use, approved 26 September 1997, and both are discontinued, and a Federal Register determination on the FDA record says that ending was not a safety or effectiveness matter. That is a real and unusual history. It attaches to a product made by EMD Serono under a reviewed process, not to a vial from a research supplier, and a listing that blurs the two is claiming an approval it does not hold.
The evidence base deserves the same treatment. Of the 332 PubMed records that mention this compound, three carry it in the title, and pairing it with anti-aging returns nothing at all. A supplier is not responsible for that gap, and a supplier that implies the gap has been filled has made a claim it cannot document. The field-by-field version of this exercise, run against the listing rather than the seller, is the listing walkthrough.
Frequently asked questions
- What is the single most useful criterion when choosing a sermorelin supplier?
- Whether the certificate names the lot you are being sold. Everything else follows from that. Purity, quantity, method and analyst are only meaningful if they describe the material in the box, and a certificate with no lot number, or with a lot number that does not appear on the vial, describes somebody else's powder. It is also the criterion most easily failed, because it takes one field to fail it.
- How do I confirm the vial holds sermorelin and not a similar peptide?
- Two independent descriptions have to agree. The certificate prints a sequence; converted from three-letter to single-letter code it should read YADAIFTNSYRKVLGQLSARKLLQDIMSR, twenty-nine residues, with a C-terminal amide, which is GHRH(1-29) amide. PubChem CID 16132413 should return the formula C149H246N44O42S and a molecular weight of 3357.9. If the sequence is short, the residue count is wrong, or the formula does not match, the document is describing a different compound.
- Does the linked supplier pass every criterion on this page?
- No. The certificate for lot 38-01260229 reports purity of 99.79 percent and a measured quantity of 11.31 mg by HPLC-UV-MS, which passes the identity, purity, quantity and traceability criteria. It carries no bacterial endotoxin result and no sterility screen, which fails the microbiological criterion outright for anyone treating a reconstituted powder as a parenteral preparation. We link the supplier and we mark it down on that line, because the alternative is a scorecard that only ever produces one answer.
- Is a supplier that ships from inside the United States automatically better?
- Not automatically, but it removes a category of failure rather than improving the material. Domestic stock shortens transit, avoids a customs interception, and gives a buyer a counterparty inside a jurisdiction where a refund claim means something. None of that changes what the powder is. A domestic seller with no lot-level certificate is still selling an unverifiable product, faster.
- Where does the prescription route sit against these criteria?
- Outside them, because it is graded on a different document. Sermorelin was approved as Geref, both applications are discontinued, and the substance does not appear on FDA's list of bulk substances flagged as presenting significant safety risks for compounding, which is why a pharmacy filling a prescription can use it. That route gives you a pharmacy label instead of a certificate. This page grades certificates, and a certificate is what a research supplier gives you.
Limitations of the evidence
This is a method applied to one supplier, not a survey of the market. We hold one certificate, for one lot, from one laboratory, and we did not commission testing of our own or open a vial. Criteria that depend on conduct rather than documents, such as refund handling and how a seller behaves when a shipment goes wrong, cannot be graded from public information and are marked ungradeable rather than passed. Prices are the vendor's published figures at the review date. Sermorelin was approved in the United States as Geref and both applications are discontinued, so no current label sets a specification this material must meet, and nothing here describes or recommends human use.
References
Citations are annotated with an evidence tier reflecting study design and replication. See Methodology for criteria.
- 1.MZ Biolabs, for Ascension Peptides · Certificate of Analysis, sermorelin, lot 38-01260229, quantitative HPLC-UV-MS, analysed 7 February 2026 · 2026Validated
- 2.National Center for Biotechnology Information · PubChem Compound Summary, CID 16132413, Sermorelin · 2026Validated
- 3.U.S. Food and Drug Administration · Certain Bulk Drug Substances for Use in Compounding That May Present Significant Safety Risks · 2026Validated
- 4.U.S. Food and Drug Administration · Pyrogen and Endotoxins Testing: Questions and Answers · 2012Validated
- 5.U.S. Food and Drug Administration · Drugs@FDA record, NDA 019863, GEREF Diagnostic (sermorelin acetate), EMD Serono · 1991Validated