Buy Sermorelin Peptide: 3357.9 g/mol or Something Else

Buy sermorelin peptide and the word doing the work in that phrase is the last one. A peptide is a defined object: a sequence, a residue count, a formula and a mass. Every one of those is published, and every one of them can be checked against a vendor’s own document in about a minute.

That matters here more than usual, because four molecules are sold as one category. They have different targets, different regulatory positions and different literatures, and the only thing that reliably separates them on a certificate is arithmetic.

Buy sermorelin peptide: the numbers that define it

Sermorelin is a synthetic 29-amino-acid peptide equal to the active N-terminal fragment of human growth hormone-releasing hormone, written GHRH(1-29) amide. In single-letter code the sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR, terminating in an amide rather than a free acid. Its molecular formula is C149H246N44O42S and its molecular weight is 3357.9.

Mechanically it is a secretagogue. It binds the growth hormone-releasing hormone receptor on the anterior pituitary and prompts release of the body’s own growth hormone, which is a categorically different thing from administering recombinant growth hormone. That distinction is the honest answer to the most common question buyers ask about this compound, and it also explains why the two have entirely separate regulatory records.

None of those figures is proprietary. PubChem CID 16132413 returns the title Sermorelin with the same formula and the same 3357.9 mass, which means a vendor’s description and a public database can be compared directly by anyone. The compound’s own research record, including where the evidence stops, is our summary of the literature.

Running the identity check on a real certificate

Take the document for lot 38-01260229, issued by MZ Biolabs of Tucson, Arizona and analysed on 7 February 2026. It prints the peptide sequence in three-letter code. Converting it gives YADAIFTNSYRKVLGQLSARKLLQDIMSR. Counting gives twenty-nine residues. The C-terminal amide is noted. That combination is canonical GHRH(1-29) amide, so the document is describing sermorelin.

The second half of the check is the mass. The vendor states C149H246N44O42S at 3357.9 g/mol; PubChem CID 16132413 returns the same formula and the same mass. Agreement between two sources that were not derived from each other is a weak positive on its own. A disagreement, though, would be a strong negative, and that asymmetry is what makes the check worth the minute it takes: it cannot prove the vial is right, and it can prove a document is wrong.

The same certificate puts purity at 99.79 percent and quantity at 11.31 mg on a 10 mg label, both by HPLC-UV-MS across four detected peaks. It carries no bacterial endotoxin result and no sterility screen, which is a property of that lot rather than of the product, and it is the line worth deciding about before purchase rather than after.

Two failure modes this check catches are worth naming, because they look different on paper and fail for the same reason. The first is a truncated sequence: a fragment shorter than twenty-nine residues is a different molecule with a different mass, and the residue count exposes it without any chemistry. The second is a certificate that prints a name and a purity figure and no sequence at all, which cannot be checked in either direction. A document that gives you a percentage and withholds the structure has asked for trust precisely where verification was available.

Four compounds sold as one category

These are routinely listed side by side, cross-sold to each other, and discussed as though the choice between them were a matter of preference. They are four different molecules with four different positions.

Column four is the one nobody expects. FDA’s Category 2 list catalogues the bulk drug substances that may present significant safety risks in compounding, and sermorelin is absent from it in every section, active and withdrawn. GHRP-2, GHRP-6 and kisspeptin-10 are listed. BPC-157, Melanotan II, Selank, Semax, MOTS-c and epitalon were nominated and withdrawn. That absence is the reason a lawful prescription route exists here, and it is checkable in a few minutes. The stack that pairs two of these molecules is covered in our note on CJC-1295 and ipamorelin.

The trial search that appears to answer and does not

Search ClinicalTrials.gov for this compound and dozens of studies come back, which reads like a healthy registered literature. Open them and none names sermorelin as an intervention. They are trials of growth hormone-releasing hormone, of tesamorelin and of octreotide, surfaced because the registry matches synonyms and related terms.

That result deserves care rather than dismissal. Sermorelin is GHRH(1-29), so some of the GHRH literature genuinely bears on it. A trial of a stabilised analog is still a trial of a different molecule with different pharmacokinetics, and treating the two as one is exactly the substitution the table above exists to prevent. The practical rule is simple: there are no registered trials naming this compound, so any page quoting a study identifier for it is quoting a study about something else.

PubMed gives the same shape of answer more honestly. It returns 332 papers mentioning sermorelin, three with the word in the title, and zero for the compound alongside anti-aging. Of those three, one is a 1999 review of use in children with idiopathic growth hormone deficiency, one is a 2006 discussion of adult-onset growth hormone insufficiency, and the third concerns recurrent glioma and has no bearing on anything a buyer is asking about. That is the whole title literature, and it is worth knowing its size before reading a page that implies otherwise.

What identity does and does not settle

Confirming that a document describes GHRH(1-29) amide settles the question of which molecule you are buying. It settles nothing about purity beyond what the same certificate reports, nothing about endotoxin load, and nothing about what the material does.

The regulatory history sits in the same category: real, and about a product rather than a vial. Geref carried NDA 019863 for pituitary diagnostics and NDA 020443 for therapeutic use, approved 26 September 1997, both from EMD Serono. Neither is marketed now, and the Federal Register determination on that record excludes safety and effectiveness as the reason. The approved indications were paediatric growth hormone deficiency and pituitary diagnostics, which is a narrower territory than the market implies.

The linked vial carries a $99.99 list and a $72.00 site price, and the code brings it to $36.00: $3.60 a labelled milligram, $3.18 against what that lot assayed. The compound most often mistaken for this one, and the only member of the group holding a current approval, is covered in our note on tesamorelin.